PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG097300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28001.1 Da    PI: 9.7696
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG097300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.3e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+iifs++gklyey++
  Pavir.9NG097300.1.p  9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIIFSTKGKLYEYAT 59
                         79***********************************************86 PP

2K-box104.81e-34781744100
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                          +   s+e++++ ++++e++ Lk+++e++q+ q+hl+GedLe+L+lkeLqqLeqqLe+slk+iRs+K++l++e+i+elq+kek+lqeenk 
  Pavir.9NG097300.1.p  78 KVLISAESETQGNWCHEYRMLKAKVETIQKCQKHLMGEDLETLNLKELQQLEQQLESSLKHIRSRKSQLMMESISELQRKEKSLQEENKI 167
                          555667888999****************************************************************************** PP

                K-box  94 Lrkklee 100
                          L+k+l+e
  Pavir.9NG097300.1.p 168 LQKELAE 174
                          ***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.969161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-34289IPR002100Transcription factor, MADS-box
CDDcd002652.10E-42276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.6E-3084172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.87488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIIFST KGKLYEYATD  60
TSMDKILERY ERYSYAEKVL ISAESETQGN WCHEYRMLKA KVETIQKCQK HLMGEDLETL  120
NLKELQQLEQ QLESSLKHIR SRKSQLMMES ISELQRKEKS LQEENKILQK ELAEKQKAQR  180
QQAQWDQTQQ QTSSSSSSFM MREAPPATNI SSYPVAAGGR VEGPAAQPQA RIGLPPWMLS  240
HISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-24174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-24174173Myocyte-specific enhancer factor 2B
1tqe_R3e-24174173Myocyte-specific enhancer factor 2B
1tqe_S3e-24174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.174670.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306410.0AJ430641.1 Zea mays mRNA for putative MADS-domain transcription factor (m4 gene).
GenBankBT0856810.0BT085681.1 Zea mays full-length cDNA clone ZM_BFc0047E01 mRNA, complete cds.
GenBankKJ7275090.0KJ727509.1 Zea mays clone pUT5368 MADS transcription factor (MADS4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981740.11e-151PREDICTED: MADS-box transcription factor 14 isoform X1
SwissprotQ10CQ11e-138MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA0A0A9QQM81e-147A0A0A9QQM8_ARUDO; Uncharacterized protein
STRINGSb01g007790.11e-137(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-75MIKC_MADS family protein